RetrogeneDB ID: | retro_ptro_2496 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 6:154655077..154655280(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | INTS5 | ||
| Ensembl ID: | ENSPTRG00000003777 | ||
| Aliases: | None | ||
| Description: | None |
Retrocopy-Parental alignment summary:
>retro_ptro_2496
GGGATCCCGGGGGGAAAAATCAACTGGCGCCGAACCGAGCTGAAGAAAAAGCTGATCAGCGCAGGCCGGTGTTGAACCGC
AAGCAGCGTCTGAGGCACTGGGTGGTCGAGGCTGTGATAGATCAAGCGCTGATCACGCGGCACCACCTCAAGAAGCAGGC
ATCCAGTGCACGTGCCAACATTACTCTGTAGGGGAAGAAGCAA
ORF - retro_ptro_2496 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 76.81 % |
| Parental protein coverage: | 68.69 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
Retrocopy - Parental Gene Alignment:
| Parental | GAPGGKINRPRTELKKKLF-KRRRVLNRERRLRHRVVGAVIDQGLITRHHLKKRSSSARANITLSGKKR |
| G.PGGKIN..RTELKKKL...RR.VLNR..RLRH.VV.AVIDQ.LITRHHLKK..SSARANITL.GKK. | |
| Retrocopy | GIPGGKINWRRTELKKKLI<QRRPVLNRKQRLRHWVVEAVIDQALITRHHLKKQASSARANITL*GKKQ |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 21 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 17 .42 RPM |
| SRP007412_heart | 0 .00 RPM | 6 .97 RPM |
| SRP007412_kidney | 0 .00 RPM | 24 .24 RPM |
| SRP007412_liver | 0 .00 RPM | 28 .77 RPM |
| SRP007412_testis | 0 .11 RPM | 13 .81 RPM |
Pan troglodytes was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_ptro_2496 retrocopy.
Pan troglodytes was not studied using FANTOM5 data.
retro_ptro_2496 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_ptro_2496 has 2 orthologous retrocopies within eutheria group .| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3681 |
| Macaca mulatta | retro_mmul_1785 |
Parental genes homology:
Parental genes homology involve 1 parental gene, and 1 retrocopy.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Pan troglodytes | ENSPTRG00000003777 | 1 retrocopy |
retro_ptro_2496 ,
|