RetrogeneDB ID: | retro_ptro_1965 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 4:3389068..3389293(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | XAGE3 | ||
| Ensembl ID: | ENSPTRG00000021922 | ||
| Aliases: | None | ||
| Description: | X antigen family, member 3 [Source:HGNC Symbol;Acc:14618] |
| Percent Identity: | 72.0 % |
| Parental protein coverage: | 67.57 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MIWRGRSTYRPRPRRSVPPPELIGPMLEPGDEEPQQEEPPTESRDPAPGQEREEDQGAAEIQVPDLEADL |
| M.W.GRS..R.RPRR...PPEL.GP.LEP.DE.PQQE.PP.ESR.P.PGQEREED.GAAEI.V.D.EADL | |
| Retrocopy | MSWQGRSACRLRPRRYLQPPELTGPVLEPSDEQPQQEAPPPESRGPTPGQEREEDHGAAEILVLDQEADL |
| Parental | QELSQ |
| .ELSQ | |
| Retrocopy | RELSQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .11 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .03 RPM |
| SRP007412_liver | 0 .03 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .53 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_2013 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Gorilla gorilla | ENSGGOG00000027404 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000020369 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000021922 | 1 retrocopy |
retro_ptro_1965 ,
|