RetrogeneDB ID: | retro_ogar_3370 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873806.1:1654..1903(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SMIM14 | ||
| Ensembl ID: | ENSOGAG00000007152 | ||
| Aliases: | None | ||
| Description: | small integral membrane protein 14 [Source:HGNC Symbol;Acc:27321] |
| Percent Identity: | 84.34 % |
| Parental protein coverage: | 83.84 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILMAWMVIAVILFLL |
| MAEGGF.PCECVCSHEHA.RRLINLL..SQSYCTD.ECLQ.L.GP.GDNGI.VTM.LMA.MVIAVILFLL | |
| Retrocopy | MAEGGFNPCECVCSHEHAIRRLINLLW*SQSYCTDIECLQKLLGPCGDNGINVTMTLMALMVIAVILFLL |
| Parental | RPPNLRGSNLSGK |
| RP.NL.GSNLSGK | |
| Retrocopy | RPLNLKGSNLSGK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000023287 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000001693 | 2 retrocopies | |
| Homo sapiens | ENSG00000163683 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000002601 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000006076 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017113 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000007152 | 4 retrocopies |