RetrogeneDB ID: | retro_ocun_585 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 12:129224165..129224386(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSOCUG00000009867 | ||
| Aliases: | None | ||
| Description: | Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial [Source:UniProtKB/TrEMBL;Acc:G1SY25] |
| Percent Identity: | 54.67 % |
| Parental protein coverage: | 52.94 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | ADRLRQVDTDGVEPMESVLEDRCLYLRSDNVVEG-NCAEELLQNSHRVVEEYFVAPPGN--IPLPKLDEQ |
| ...LR.VDTD.V.PMES.LED.CL.L..DN..EG..C.EELLQNS.R..EEYF...P.....P..K.... | |
| Retrocopy | SEQLRAVDTDRVGPMESLLEDGCLHLTFDNAGEG<HCEEELLQNSGRGGEEYFAPRPHHEYSPFAKAG*T |
| Parental | ESFPH |
| E.FPH | |
| Retrocopy | ERFPH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 8 .44 RPM |
| SRP017611_kidney | 0 .00 RPM | 9 .73 RPM |
| SRP017611_liver | 0 .08 RPM | 4 .01 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000013298 | 1 retrocopy | |
| Equus caballus | ENSECAG00000011118 | 1 retrocopy | |
| Felis catus | ENSFCAG00000024015 | 1 retrocopy | |
| Homo sapiens | ENSG00000257218 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000015651 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000009867 | 2 retrocopies |
retro_ocun_585 , retro_ocun_858,
|
| Ochotona princeps | ENSOPRG00000004226 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000005030 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000005534 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000009907 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000006845 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000000144 | 1 retrocopy |