RetrogeneDB ID: | retro_ocun_359 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 1:47261248..47261482(-) | ||
| Located in intron of: | ENSOCUG00000006819 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TEX12 | ||
| Ensembl ID: | ENSOCUG00000002174 | ||
| Aliases: | None | ||
| Description: | testis expressed 12 [Source:HGNC Symbol;Acc:11734] |
| Percent Identity: | 55.0 % |
| Parental protein coverage: | 65.04 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MMASHLVKPDTRSCKRPRETEPQMPDSPQLSSLGKSDSLCSESSGLFYKDEALEKDLNEMSKEINLMLST |
| MMA.HLVKPD.....RP.E...Q.PD...L.SLG.SDS..SE.S..FYKDEAL.K.LN..SK.I.L.L.. | |
| Retrocopy | MMANHLVKPDIGNSMRPGELKHQIPDASELPSLGNSDSHYSENSQRFYKDEALKKYLNDISKGITLKLFK |
| Parental | YAKILSERAA |
| Y....SER.. | |
| Retrocopy | YTE--SERSS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 0 .17 RPM |
| SRP017611_kidney | 0 .00 RPM | 0 .10 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .23 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000009900 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000002174 | 1 retrocopy |
retro_ocun_359 ,
|
| Tarsius syrichta | ENSTSYG00000006348 | 1 retrocopy |