RetrogeneDB ID: | retro_mputfur_863 | ||
Retrocopy location | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL896961.1:5878447..5878659(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SPINK2 | ||
| Ensembl ID: | ENSMPUG00000004749 | ||
| Aliases: | None | ||
| Description: | serine peptidase inhibitor, Kazal type 2 (acrosin-trypsin inhibitor) [Source:HGNC Symbol;Acc:11245] |
| Percent Identity: | 61.11 % |
| Parental protein coverage: | 78.89 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | GGSMALSAVRLVLLLLAADLAASLDSLSSEFD-QPSEYRTPNCNQYKLPGCPRDFSPVCGSDMSTYPNEC |
| GGSMA.......LL....DLA.SLDS.....D.QPSE.RT.NC.QYK.PGCPRD.S..CG.DMS.YPN.C | |
| Retrocopy | GGSMAVLVLHVALLFPDRDLAVSLDSELLSVD<QPSECRTSNCDQYK*PGCPRDLSAGCGKDMSAYPNQC |
| Parental | TL |
| TL | |
| Retrocopy | TL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000014129 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000004749 | 1 retrocopy |
retro_mputfur_863 ,
|