RetrogeneDB ID: | retro_mmus_492 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 1:139790077..139790304(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Cfhr3 | ||
| Ensembl ID: | ENSMUSG00000090623 | ||
| Aliases: | None | ||
| Description: | complement factor H-related 3 [Source:MGI Symbol;Acc:MGI:3647418] |
Retrocopy-Parental alignment summary:
>retro_mmus_492
CAAGATGGACAATTACTTAATGAGACTTTATTTTGCTCCTCAGATAATTTCTGTGGGAATCCACACATGTGGCAAATGCT
ATTATAGTAACAAGGCCCCTGGCTAAATATCCATCTGGTGACAGATTACATTATGAATGTAATAAACATTTTGAACTATT
TGGGGATGTAGAAGACGTGTGTCAAAATGGGATTTGGACAGAACAACTGAAATGCAAACGGAGAACA
ORF - retro_mmus_492 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 55.84 % |
| Parental protein coverage: | 55.15 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
Retrocopy - Parental Gene Alignment:
| Parental | QNGWSLQPSCIIITD-YCVNP-PHVPNATIVTMPMAKYPSGEKIHYECHKPFELFGKVEVMCQNGMWTEP |
| Q.G..L........D..C.NP..HV.NA.IVT.P.AKYPSG...HYEC.K.FELFG.VE..CQNG.WTE. | |
| Retrocopy | QDGQLLNETLFCSSDNFCGNP<THVANAIIVTRPLAKYPSGDRLHYECNKHFELFGDVEDVCQNGIWTEQ |
| Parental | PRCKDPT |
| ..CK..T | |
| Retrocopy | LKCKRRT |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .03 RPM | 3 .09 RPM |
| SRP007412_testis | 0 .00 RPM | 2 .38 RPM |
RNA Polymerase II activity near the 5' end of retro_mmus_492 was not detected
No EST(s) were mapped for retro_mmus_492 retrocopy.
No TSS is located nearby retro_mmus_492 retrocopy 5' end.
retro_mmus_492 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_mmus_492 has 0 orthologous retrocopies within eutheria group .Parental genes homology:
Parental genes homology involve 2 parental genes, and 2 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Mus musculus | ENSMUSG00000016481 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000090623 | 1 retrocopy |
retro_mmus_492 ,
|