RetrogeneDB ID: | retro_mluc_1560 | ||
Retrocopy location | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | GL429862:2061500..2061725(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMEM134 | ||
| Ensembl ID: | ENSMLUG00000005143 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 84.21 % |
| Parental protein coverage: | 61.79 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | NLENDEEGAQVSPEPDGGVNTRDSGRTSSVRSSQWSFSTISNSTQRSYNACCSWTQHPLIQKNRKVVLAS |
| NLENDE.GA.VS.EPDGGV.TRDSG.TS.V.SSQWSFSTISNSTQ.SYNACC.WT.HPLIQKN..VVLAS | |
| Retrocopy | NLENDEYGARVSLEPDGGVSTRDSG*TS-VHSSQWSFSTISNSTQHSYNACCNWT*HPLIQKNHRVVLAS |
| Parental | FLLLLL |
| FLLLLL | |
| Retrocopy | FLLLLL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Equus caballus | ENSECAG00000016857 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000005143 | 1 retrocopy |
retro_mluc_1560 ,
|
| Rattus norvegicus | ENSRNOG00000022153 | 1 retrocopy |