RetrogeneDB ID: | retro_mdom_1239 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 4:58901939..58902379(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMODG00000007447 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 77.48 % |
| Parental protein coverage: | 50.87 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | MLRRTLENRDAQTKQLQDAVSNVEKHFGELCQIFAAYVRKTARLRDKADLLVN----EINAYAATETPNL |
| MLRRTLENR.AQTKQLQD.VSN.EKHFG...QIFA..V.KTARL..KADL.VN....EIN.YAAT.TPNL | |
| Retrocopy | MLRRTLENREAQTKQLQDVVSNLEKHFG---QIFAT*VGKTARLQYKADLIVNEINGEINSYAATKTPNL |
| Parental | KHGLKDFADEFAKLQDYRQAEVERLEAKVVEPLKSYGTIVKMKRDDLKATLTAKSREAKQLTQLE-RTRQ |
| KH.LKDFADEFAKLQDY.QAEVERLEAKVVEPLKSYG.IVKMK.DDLKATLTAKS.EA.QLTQLE....Q | |
| Retrocopy | KHNLKDFADEFAKLQDYWQAEVERLEAKVVEPLKSYGIIVKMKWDDLKATLTAKS*EANQLTQLE<NHGQ |
| Parental | RNPSDRHVISQ |
| .NP...HV..Q | |
| Retrocopy | WNPPELHVSFQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000009105 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000013003 | 1 retrocopy | |
| Homo sapiens | ENSG00000188343 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000006452 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000003954 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000006797 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000007447 | 2 retrocopies |
retro_mdom_1239 , retro_mdom_827,
|
| Mustela putorius furo | ENSMPUG00000009112 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000002773 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000002972 | 1 retrocopy | |
| Oreochromis niloticus | ENSONIG00000002446 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000011171 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000018744 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000012502 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000012378 | 1 retrocopy |