RetrogeneDB ID: | retro_mdom_1165 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 3:328735894..328736117(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TRAPPC2L | ||
| Ensembl ID: | ENSMODG00000003889 | ||
| Aliases: | None | ||
| Description: | trafficking protein particle complex 2-like [Source:HGNC Symbol;Acc:30887] |
| Percent Identity: | 53.33 % |
| Parental protein coverage: | 52.52 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | KALVDQRELYLGLLYPT-EDYKVYGYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYT-DVMCNPF |
| K.LVDQRE.Y..LL.P..E.Y...GYV..SK.KFV.....S...L.DN...SM...LHNSY...V..NPF | |
| Retrocopy | KRLVDQRESY*NLLCPPREGYQISGYVAHSKRKFVTMLGPSSITLWDNNMHSML*RLHNSYS>GVIHNPF |
| Parental | YNPGD |
| .NPGD | |
| Retrocopy | HNPGD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000003547 | 1 retrocopy | |
| Homo sapiens | ENSG00000167515 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000003889 | 2 retrocopies |
retro_mdom_1165 , retro_mdom_1391,
|
| Rattus norvegicus | ENSRNOG00000014581 | 3 retrocopies |