RetrogeneDB ID: | retro_etel_1888 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_311874:44342..44552(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TRAPPC2L | ||
| Ensembl ID: | ENSETEG00000003547 | ||
| Aliases: | None | ||
| Description: | trafficking protein particle complex 2-like [Source:HGNC Symbol;Acc:30887] |
| Percent Identity: | 88.73 % |
| Parental protein coverage: | 50.71 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | YGYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNPGDRIHSSRAFDSTVTSMMTQV |
| YGYVTNSKV.FVMVVD.SN.ALR.NEI.SMFRKLHNSYTDVMCNPFYNPGD.IH.SRAFDSTVTSMMT.V | |
| Retrocopy | YGYVTNSKVEFVMVVDLSNKALRVNEICSMFRKLHNSYTDVMCNPFYNPGDCIH-SRAFDSTVTSMMTHV |
| Parental | C |
| C | |
| Retrocopy | C |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000003547 | 1 retrocopy |
retro_etel_1888 ,
|
| Homo sapiens | ENSG00000167515 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000003889 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000014581 | 3 retrocopies |