RetrogeneDB ID: | retro_lcha_22 | ||
Retrocopy location | Organism: | Coelacanth (Latimeria chalumnae) | |
| Coordinates: | JH126562.1:6131472..6131718(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CHIC2 | ||
| Ensembl ID: | ENSLACG00000006603 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 85.54 % |
| Parental protein coverage: | 50.3 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | VFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSK |
| .FGLSNKF.SEFPSSLTGKVAPEEFKASINRVNSC.KK.LPV.VRW.LCG...CCCTLGCSMWPVICLSK | |
| Retrocopy | LFGLSNKFKSEFPSSLTGKVAPEEFKASINRVNSCPKKTLPVKVRWFLCGYF-CCCTLGCSMWPVICLSK |
| Parental | RTRRSIEKLLEWE |
| RT.RSIEKL.E.E | |
| Retrocopy | RT*RSIEKLFE*E |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| DRP000627_gill | 0 .00 RPM | 0 .32 RPM |
| DRP000627_kidney | 0 .00 RPM | 0 .35 RPM |
| DRP000627_pectoral_fin | 0 .00 RPM | 1 .03 RPM |
| DRP000627_pelvic_fin | 0 .00 RPM | 0 .65 RPM |
| DRP000627_pharynx | 0 .00 RPM | 0 .41 RPM |
| DRP000627_tail_muscle | 0 .00 RPM | 0 .43 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000024493 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000004296 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000006603 | 1 retrocopy |
retro_lcha_22 ,
|
| Loxodonta africana | ENSLAFG00000012248 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006382 | 1 retrocopy |