RetrogeneDB ID: | retro_ggor_782 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 12:22287480..22287915(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | THEM4 | ||
| Ensembl ID: | ENSGGOG00000008114 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 95.86 % |
| Parental protein coverage: | 60.42 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | DPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQGGPYLEGPPGFIHGGAIATMIDATVG |
| DPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYND.EKRMVCLFQG.PYLEGPPGF.HGGAIATMIDATVG | |
| Retrocopy | DPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDVEKRMVCLFQGVPYLEGPPGFVHGGAIATMIDATVG |
| Parental | MCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEKTLYSEATSLFIKLNP |
| MCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEKT.YSEATS.FIKLNP | |
| Retrocopy | MCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEKTSYSEATSVFIKLNP |
| Parental | DKSLT |
| .KSLT | |
| Retrocopy | AKSLT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 16 .06 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 12 .10 RPM |
| SRP007412_heart | 0 .00 RPM | 6 .44 RPM |
| SRP007412_kidney | 0 .04 RPM | 34 .43 RPM |
| SRP007412_liver | 0 .00 RPM | 9 .65 RPM |
| SRP007412_testis | 0 .00 RPM | 37 .61 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_978 |
| Pan troglodytes | retro_ptro_768 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000355 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000000818 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000005970 | 1 retrocopy | |
| Felis catus | ENSFCAG00000003443 | 1 retrocopy | |
| Homo sapiens | ENSG00000159445 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000008114 | 2 retrocopies |
retro_ggor_1195, retro_ggor_782 ,
|
| Microcebus murinus | ENSMICG00000010696 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000010322 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000005194 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000000851 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000001301 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000003352 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000005739 | 1 retrocopy |