RetrogeneDB ID: | retro_ggor_1905 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 3:188044908..188045126(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C19ORF79 | ||
| Ensembl ID: | ENSGGOG00000027594 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 90.91 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MGVKLEIFRMIIYLTFPVAMFWVSNQAEWFEDDVIQRKRELWPPEKVTVLQEIEEFKERLRKRREE-KLL |
| MGVK..IFRMIIYLTFPVAMFWVSNQAEWFEDDVIQRKRELWPPEK...LQE.EEFKERLRKRREE.KLL | |
| Retrocopy | MGVKPKIFRMIIYLTFPVAMFWVSNQAEWFEDDVIQRKRELWPPEK---LQELEEFKERLRKRREE<KLL |
| Parental | RDAQQNS |
| RDAQQNS | |
| Retrocopy | RDAQQNS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .72 RPM | 22 .59 RPM |
| SRP007412_cerebellum | 0 .43 RPM | 14 .14 RPM |
| SRP007412_heart | 0 .78 RPM | 23 .67 RPM |
| SRP007412_kidney | 1 .64 RPM | 32 .55 RPM |
| SRP007412_liver | 1 .16 RPM | 22 .79 RPM |
| SRP007412_testis | 1 .66 RPM | 25 .17 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pan troglodytes | retro_ptro_120 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000008524 | 2 retrocopies | |
| Equus caballus | ENSECAG00000008451 | 1 retrocopy | |
| Felis catus | ENSFCAG00000023931 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000027594 | 1 retrocopy |
retro_ggor_1905 ,
|
| Pan troglodytes | ENSPTRG00000039245 | 1 retrocopy |