RetrogeneDB ID: | retro_etel_1505 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_275712:6035..6218(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ACYP2 | ||
| Ensembl ID: | ENSETEG00000017888 | ||
| Aliases: | None | ||
| Description: | acylphosphatase 2, muscle type [Source:HGNC Symbol;Acc:180] |
| Percent Identity: | 83.61 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSANESLKWVAYEVLGNMQGVCFRMYTEGEAKKLGVVGWVKNTSKGTVTGQVQGPEEKVNS |
| MS..ESLK.V.YEV..N.QGVCFRMYTEGEAKKLGVV..VKNTS.GTVTGQVQGPEEKVNS | |
| Retrocopy | MSSKESLKSVDYEVFSNVQGVCFRMYTEGEAKKLGVVDCVKNTSRGTVTGQVQGPEEKVNS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000023070 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000017888 | 1 retrocopy |
retro_etel_1505 ,
|
| Oryctolagus cuniculus | ENSOCUG00000015408 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000013671 | 1 retrocopy |