RetrogeneDB ID: | retro_eeur_337 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_261733:1737..1989(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | GABARAPL2 | ||
| Ensembl ID: | ENSEEUG00000011134 | ||
| Aliases: | None | ||
| Description: | GABA(A) receptor-associated protein-like 2 [Source:HGNC Symbol;Acc:13291] |
| Percent Identity: | 71.43 % |
| Parental protein coverage: | 71.3 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | VIVEKVSGSQIVDITKRKYIVPSDITVAQFMWIIRNRIHFPSERIFFLFVDXXXXXXXL-MGQYYEKKKD |
| VIVEKVSGSQIVDI.KRKY.VPSDITVAQFMWIIR..I..PSE....LFVD.......L.MG..YE..KD | |
| Retrocopy | VIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIR*KIQLPSEKAISLFVDKTAP*SSLTMGHHYEQEKD |
| Parental | EDGFLYGAY-SENT |
| EDGFLYGAY..ENT | |
| Retrocopy | EDGFLYGAYRGENT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 9 .51 RPM | 17 .73 RPM |
| SRP017611_kidney | 11 .06 RPM | 21 .75 RPM |
| SRP017611_liver | 4 .34 RPM | 7 .23 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000005453 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000014253 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000002240 | 2 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000011134 | 1 retrocopy |
retro_eeur_337 ,
|
| Rattus norvegicus | ENSRNOG00000019425 | 1 retrocopy |