RetrogeneDB ID: | retro_eeur_103 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | GeneScaffold_6308:28526..28856(+) | ||
| Located in intron of: | ENSEEUG00000004076 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TFAM | ||
| Ensembl ID: | ENSEEUG00000006119 | ||
| Aliases: | None | ||
| Description: | transcription factor A, mitochondrial [Source:HGNC Symbol;Acc:11741] |
| Percent Identity: | 68.18 % |
| Parental protein coverage: | 76.92 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | VYEDAYKADWESYKEEMNRLQKNLTPSQIESLEKEVLQKRLKKKAIIKKRELTMLGKPKRPRTAHNIFVS |
| VYE.AY.ADWESYKEE...LQK.LTP.QIESLEKEVLQK..KKKAIIKKRELTMLGKPKRP.TA.NIF.. | |
| Retrocopy | VYEGAYRADWESYKEELSKLQKHLTPTQIESLEKEVLQKCFKKKAIIKKRELTMLGKPKRPHTAYNIFIA |
| Parental | ERFQEAKDLSVQXXXXXXXXXXXXXXXXXXXAYIQLAEDD |
| ERFQE.KDLS.Q....................YIQLAEDD | |
| Retrocopy | ERFQETKDLSAQGRLRSVNKSWKNLTSSQKQVYIQLAEDD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .48 RPM | 6 .28 RPM |
| SRP017611_kidney | 0 .19 RPM | 12 .57 RPM |
| SRP017611_liver | 0 .64 RPM | 11 .90 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000000535 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000014013 | 2 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000006119 | 3 retrocopies |
retro_eeur_103 , retro_eeur_182, retro_eeur_652,
|
| Homo sapiens | ENSG00000108064 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000004948 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000012891 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000008802 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000019829 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000012295 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000014405 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000002430 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000002519 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000613 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000009246 | 1 retrocopy |