RetrogeneDB ID: | retro_ecab_900 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 6:37879419..37879831(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBE2V1 | ||
| Ensembl ID: | ENSECAG00000011858 | ||
| Aliases: | None | ||
| Description: | ubiquitin-conjugating enzyme E2 variant 1 [Source:HGNC Symbol;Acc:12494] |
| Percent Identity: | 57.86 % |
| Parental protein coverage: | 92.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | VKVPRNFRLLEELEEG-QKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPE |
| VK....F..LEELEE...K.VGDG.VS..L.D.EDMTLTRWT..IIGPPRT.Y.NRI.SLK.E..PKYPE | |
| Retrocopy | VKFTYDFYFLEELEED<PKRVGDGKVS*DLKDGEDMTLTRWTDVIIGPPRTNYKNRICSLKVEYVPKYPE |
| Parental | APPFVRFVTKINMNGVNSSNGVVDPRAI-SVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYS |
| A.....FV.KINMNG.N..NG..D.........K..N.YSIKVV..E.R.L....ENM.LPQ.PE.Q.Y. | |
| Retrocopy | ALLSIKFVNKINMNGINNTNGILDAQST<TTVSKIENLYSIKVVV*EQRHLILWNENMMLPQSPERQLYN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 10 .21 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 35 .26 RPM |
| SRP021940_embryo | 0 .10 RPM | 37 .75 RPM |
| SRP021940_placental_villous | 0 .05 RPM | 35 .17 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 19 .99 RPM |
| SRP021940_testis | 0 .00 RPM | 56 .46 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Equus caballus | ENSECAG00000011858 | 3 retrocopies |
retro_ecab_1112, retro_ecab_250, retro_ecab_900 ,
|
| Homo sapiens | ENSG00000244687 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000012228 | 6 retrocopies | |
| Otolemur garnettii | ENSOGAG00000025894 | 12 retrocopies | |
| Pan troglodytes | ENSPTRG00000013615 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000025580 | 21 retrocopies |
retro_rnor_1014, retro_rnor_1032, retro_rnor_1291, retro_rnor_1609, retro_rnor_1649, retro_rnor_1650, retro_rnor_1651, retro_rnor_2055, retro_rnor_2282, retro_rnor_2406, retro_rnor_2407, retro_rnor_2412, retro_rnor_2488, retro_rnor_2489, retro_rnor_2490, retro_rnor_2534, retro_rnor_2535, retro_rnor_2905, retro_rnor_819, retro_rnor_881, retro_rnor_991,
|
| Ictidomys tridecemlineatus | ENSSTOG00000014322 | 6 retrocopies |