RetrogeneDB ID: | retro_ecab_596 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 22:34818278..34818509(-) | ||
| Located in intron of: | ENSECAG00000021884 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMEM18 | ||
| Ensembl ID: | ENSECAG00000008640 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 18 [Source:HGNC Symbol;Acc:25257] |
| Percent Identity: | 74.36 % |
| Parental protein coverage: | 55.71 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MPSPFSVSSFPVSIPAVIAQTDWTEPWLLGLGGFHLLCLLLTWFSSKRYRLQVGHFLCLIALVCCAESIN |
| M.S.FSVSSFP.SIPAVI.QTD.TE..L.GL.GFH...LLLT.FS..RY.L.VGHFLCLI.LVCCAE.IN | |
| Retrocopy | MLSAFSVSSFPTSIPAVIMQTDRTELRLIGLPGFHVVWLLLTCFSFQRYKL*VGHFLCLI-LVCCAEYIN |
| Parental | EVAALNWR |
| EVAA.NWR | |
| Retrocopy | EVAAMNWR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .30 RPM | 6 .91 RPM |
| SRP021940_cerebellum | 0 .05 RPM | 12 .93 RPM |
| SRP021940_embryo | 0 .03 RPM | 12 .27 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 9 .24 RPM |
| SRP021940_synovial_membrane | 0 .05 RPM | 9 .44 RPM |
| SRP021940_testis | 0 .13 RPM | 48 .66 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000000543 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012522 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000001854 | 1 retrocopy | |
| Equus caballus | ENSECAG00000008640 | 1 retrocopy |
retro_ecab_596 ,
|
| Monodelphis domestica | ENSMODG00000014284 | 1 retrocopy |