RetrogeneDB ID: | retro_dnov_2186 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_53937:4930..5286(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | STYX | ||
| Ensembl ID: | ENSDNOG00000016631 | ||
| Aliases: | None | ||
| Description: | serine/threonine/tyrosine interacting protein [Source:HGNC Symbol;Acc:11447] |
| Percent Identity: | 68.25 % |
| Parental protein coverage: | 54.71 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 4 |
| Parental | TKEFIDGSFQTGGKVLVHGNAGISRSAAFVIAYIMETFGM-KYRDAFAYVQERRFCINPNAGFVHQLQEY |
| TK.FID....TG.KV.VH.N..IS.SA.FV.....ETFG..KYRDAFAY.QE.RFCINPN.GFVHQLQ.Y | |
| Retrocopy | TKKFIDRHLKTGRKVHVHRNVQISGSASFVNVCTTETFGI<KYRDAFAYIQE-RFCINPNSGFVHQLQVY |
| Parental | EAI-YLAKLTIQMMSPVQIERSLSVHSGT-TGSLKRTHEED-DDFGNMQVATAQNG |
| .A..YLAKLTIQ.MSP.QIE..L.VHSGT.TGSLKRTHE.D...FG.M.VA.AQ.G | |
| Retrocopy | KAT<YLAKLTIQVMSPLQIEK-LPVHSGT<TGSLKRTHEVD<CEFGKMSVAVAQIG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 6 .03 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 3 .44 RPM |
| SRP012922_heart | 0 .00 RPM | 4 .64 RPM |
| SRP012922_kidney | 0 .00 RPM | 4 .93 RPM |
| SRP012922_liver | 0 .00 RPM | 2 .63 RPM |
| SRP012922_lung | 0 .00 RPM | 4 .89 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 11 .77 RPM |
| SRP012922_spleen | 0 .00 RPM | 5 .61 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000016631 | 9 retrocopies |
retro_dnov_1713, retro_dnov_1720, retro_dnov_1914, retro_dnov_2138, retro_dnov_2186 , retro_dnov_2218, retro_dnov_2221, retro_dnov_461, retro_dnov_66,
|
| Echinops telfairi | ENSETEG00000000561 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000029372 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000053205 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000016123 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000007956 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000014504 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000012229 | 1 retrocopy |