RetrogeneDB ID: | retro_dnov_1734 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_2797:16859..17277(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | METTL21D | ||
| Ensembl ID: | ENSDNOG00000013492 | ||
| Aliases: | None | ||
| Description: | methyltransferase like 21D [Source:HGNC Symbol;Acc:20352] |
| Percent Identity: | 59.72 % |
| Parental protein coverage: | 61.57 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | KRDGTVLRLQQYGSGGVGCV-VWDAAIVLSKYLETPGFAGDGTHSLNRRSVLELG-SGTGAVGLMAATLG |
| .....VLR.QQYGSGG.GCV.VW.AAIVLSKYL.TP.F..D..H.L..RSVLELG....GA.G.M...L. | |
| Retrocopy | RSETAVLRIQQYGSGGMGCVYVWEAAIVLSKYLATPSFSSDRAHLLSLRSVLELG<LASGAMGFMVTILR |
| Parental | -ANVVVTDLEELQDLLKMNINMNKHLVTGSVQAKVLKWGEEIEGFPSPPDYILMADXXXXXXSLEPLLKT |
| ..N.VVT.LEE.QDLLKMNINMNKHLV.GSVQ.KVLKW.E....FP.PP.YI.MA.......S....L.. | |
| Retrocopy | <TNIVVTSLEE*QDLLKMNINMNKHLVPGSVQSKVLKWEE--KDFPPPPNYIVMAKCIYYESSFNWILTL |
| Parental | LKDL |
| .K.L | |
| Retrocopy | KKFL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 2 .72 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 9 .76 RPM |
| SRP012922_heart | 0 .00 RPM | 0 .93 RPM |
| SRP012922_kidney | 0 .00 RPM | 1 .10 RPM |
| SRP012922_liver | 0 .00 RPM | 3 .25 RPM |
| SRP012922_lung | 0 .00 RPM | 4 .58 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 1 .04 RPM |
| SRP012922_spleen | 0 .00 RPM | 4 .58 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000013492 | 1 retrocopy |
retro_dnov_1734 ,
|
| Homo sapiens | ENSG00000100483 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000004994 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000005798 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000006327 | 1 retrocopy |