RetrogeneDB ID: | retro_dnov_1548 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_23283:15148..15381(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RNASEK | ||
| Ensembl ID: | ENSDNOG00000023883 | ||
| Aliases: | None | ||
| Description: | ribonuclease, RNase K [Source:HGNC Symbol;Acc:33911] |
Retrocopy-Parental alignment summary:
>retro_dnov_1548
ATGGCGGCGCTCCTGTGCTGTGGGCCCAAGCTGGCCGCCTGCGGCCTCGTCCTCAGCGTTTGGGGGGTGATCATGTTGAT
CATGCTTGGGATCTTTTCAATGTTCATTCCGCTGTGTTAATTGAGGATGTTCCCTTCACAGAGCAGGATTTTGTGAATGG
CCCCAATGACATATACGACCTTTACCCACAAGTCAACTACAACTGTTTCATCGCCGCGGGCCTTTACCTAATC
ORF - retro_dnov_1548 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 91.14 % |
| Parental protein coverage: | 79.59 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
Retrocopy - Parental Gene Alignment:
| Parental | MASLLCCGPKLAACGIVLSVWGVIMLIMLGIF-FNVHSAVLIEDVPFTEQDFENGPNDIYKLYEQVSYNC |
| MA.LLCCGPKLAACG.VLSVWGVIMLIMLGIF.FNVHSAVLIEDVPFTEQDF.NGPNDIY.LY.QV.YNC | |
| Retrocopy | MAALLCCGPKLAACGLVLSVWGVIMLIMLGIF<FNVHSAVLIEDVPFTEQDFVNGPNDIYDLYPQVNYNC |
| Parental | FIAAGLYLI |
| FIAAGLYLI | |
| Retrocopy | FIAAGLYLI |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 0 .00 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP012922_heart | 0 .00 RPM | 0 .00 RPM |
| SRP012922_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP012922_liver | 0 .00 RPM | 0 .00 RPM |
| SRP012922_lung | 0 .00 RPM | 0 .00 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 0 .00 RPM |
| SRP012922_spleen | 0 .00 RPM | 0 .00 RPM |
Dasypus novemcinctus was not studied using ChIP-Seq data.
Dasypus novemcinctus was not studied using EST data.
Dasypus novemcinctus was not studied using FANTOM5 data.
retro_dnov_1548 was not experimentally validated.
Retrocopy orthology:
Dasypus novemcinctus does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 3 parental genes, and 4 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000004064 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000023883 | 1 retrocopy |
retro_dnov_1548 ,
|
| Tarsius syrichta | ENSTSYG00000006902 | 2 retrocopies |