RetrogeneDB ID: | retro_cpor_597 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_2:14682183..14682351(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCPOG00000013590 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 51.79 % |
| Parental protein coverage: | 76.71 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSYQQQQCKQPCQPPPVVIQQQCPPVHPAPSCQQKYPPKNNLQSCIPTYCEQQQCP |
| MSY.QQQCKQ.CQPPPVVI...CP...P.P.C.....P........P..C.QQ.CP | |
| Retrocopy | MSYEQQQCKQRCQPPPVVITLKCPEPCPPPKCPELCLPSQQQCPVQPPQCCQQKCP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 0 .00 RPM |
| SRP017611_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .00 RPM |
| SRP040447_lung | 0 .00 RPM | 0 .00 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000013590 | 1 retrocopy |
retro_cpor_597 ,
|