RetrogeneDB ID: | retro_cjac_810 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 10:98833481..98833874(-) | ||
| Located in intron of: | ENSCJAG00000009911 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NT5C | ||
| Ensembl ID: | ENSCJAG00000014578 | ||
| Aliases: | None | ||
| Description: | 5', 3'-nucleotidase, cytosolic [Source:HGNC Symbol;Acc:17144] |
| Percent Identity: | 59.85 % |
| Parental protein coverage: | 66.67 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 3 |
| Parental | GLLRGFRDRFPG-EPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGF-FLDLEPIPGALDAVREMN |
| GLLR.FR..F.G.E..V.L.Q.R.FLA.EQYR.L.PDLADKVA...EA..F.F..L...PG...A..EM. | |
| Retrocopy | GLLRVFRCGFSG<ELRVTLQQHRSFLAWEQYRTLLPDLADKVAHGCEALSF<FPRLGAQPGR--ALCEMK |
| Parental | DLPDTEVFICTSPLLKYDHCVGEKYRWVEQHLGPQFLER-IILTRDKTVVLGDLLIDDKDTIRGHEE |
| ....TEVFI...PL.KYDHCVGEK.RW.EQHL.P......IILT.DKTV..GDL..DDKDTIRGH.. | |
| Retrocopy | HM*NTEVFILHQPLWKYDHCVGEKHRWLEQHLEPWRITE<IILTMDKTVIFGDLTNDDKDTIRGHNQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 5 .59 RPM |
| SRP051959_heart | 0 .05 RPM | 4 .39 RPM |
| SRP051959_kidney | 0 .09 RPM | 6 .88 RPM |
| SRP051959_liver | 0 .02 RPM | 9 .05 RPM |
| SRP051959_lung | 0 .00 RPM | 7 .60 RPM |
| SRP051959_lymph_node | 0 .07 RPM | 11 .62 RPM |
| SRP051959_skeletal_muscle | 0 .02 RPM | 8 .47 RPM |
| SRP051959_spleen | 0 .02 RPM | 7 .31 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_1109 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009175 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000014578 | 1 retrocopy |
retro_cjac_810 ,
|
| Felis catus | ENSFCAG00000031408 | 2 retrocopies | |
| Homo sapiens | ENSG00000125458 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000004740 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000017488 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000013985 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000601 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000008619 | 1 retrocopy |