RetrogeneDB ID: | retro_cjac_3674 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | ACFV01193869.1:1516..1812(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LTBP4 | ||
| Ensembl ID: | ENSCJAG00000037941 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 53.27 % |
| Parental protein coverage: | 55.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 4 |
| Parental | ESCCVVQTGVQWHDL-GSLQPPPPG---FKRFSCLSLP-SSWDYRRTPPCPANFLVLLPTGFCHV-GKAG |
| .S..V.Q..VQWHDL.GSLQ..PP....FKRFSCLSLP..SWDYR..PP.PAN...L..T.F..V....G | |
| Retrocopy | KSHSVIQAAVQWHDLSGSLQSLPPQRQEFKRFSCLSLP<NSWDYRHPPPRPAN---LVETRFQYV<SQTG |
| Parental | LKFLASSDP-PIFASQSAGITGVS-HSAENRLNIRVS |
| L..L.S.DP....ASQSAGI.GV..H.A........S | |
| Retrocopy | LELLTSGDP<AVSASQSAGILGVA<HRARDMVSFKLS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 13 .16 RPM |
| SRP051959_heart | 0 .00 RPM | 81 .88 RPM |
| SRP051959_kidney | 0 .00 RPM | 6 .41 RPM |
| SRP051959_liver | 0 .00 RPM | 1 .04 RPM |
| SRP051959_lung | 0 .00 RPM | 17 .91 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 4 .06 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 8 .63 RPM |
| SRP051959_spleen | 0 .00 RPM | 13 .36 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000017963 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000037941 | 35 retrocopies |
retro_cjac_3343, retro_cjac_3355, retro_cjac_3369, retro_cjac_3372, retro_cjac_3389, retro_cjac_3391, retro_cjac_3423, retro_cjac_3425, retro_cjac_3430, retro_cjac_3445, retro_cjac_3456, retro_cjac_3474, retro_cjac_3476, retro_cjac_3477, retro_cjac_3487, retro_cjac_3491, retro_cjac_3543, retro_cjac_3545, retro_cjac_3547, retro_cjac_3549, retro_cjac_3566, retro_cjac_3583, retro_cjac_3598, retro_cjac_3609, retro_cjac_3616, retro_cjac_3622, retro_cjac_3633, retro_cjac_3641, retro_cjac_3656, retro_cjac_3672, retro_cjac_3674 , retro_cjac_3677, retro_cjac_3682, retro_cjac_3733, retro_cjac_3736,
|