RetrogeneDB ID: | retro_cfam_507 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 12:6933996..6934217(-) | ||
| Located in intron of: | ENSCAFG00000001489 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ENSA | ||
| Ensembl ID: | ENSCAFG00000012054 | ||
| Aliases: | None | ||
| Description: | endosulfine alpha [Source:HGNC Symbol;Acc:3360] |
| Percent Identity: | 78.67 % |
| Parental protein coverage: | 61.16 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MSQKQEEENPAEETGEEKQDTQEK-EGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGD |
| MSQKQEEENPAE.TG..KQ.T.EK.EGILPE.A.EAKLKAKYPSL.QKPGGSDFLM.RLQKGQKY..... | |
| Retrocopy | MSQKQEEENPAEKTGVRKQGTWEK<EGILPEIAKEAKLKAKYPSLRQKPGGSDFLMNRLQKGQKYSEAKH |
| Parental | YNMAK |
| YNM.K | |
| Retrocopy | YNMPK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 66 .44 RPM |
| SRP017611_brain | 0 .00 RPM | 103 .13 RPM |
| SRP017611_kidney | 0 .00 RPM | 53 .03 RPM |
| SRP017611_liver | 0 .07 RPM | 12 .69 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001375 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000012054 | 1 retrocopy |
retro_cfam_507 ,
|
| Canis familiaris | ENSCAFG00000032515 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000011261 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000004647 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000002625 | 1 retrocopy |