RetrogeneDB ID: | retro_cfam_1240 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 27:13139350..13139545(-) | ||
| Located in intron of: | ENSCAFG00000028502 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCAFG00000024961 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 63.08 % |
| Parental protein coverage: | 73.03 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | KPFLAVVAGTPERSGGFIEVPGSGSTLGNPSTAGTTLRFRGGTTLGVRSEPSGTGVGGSPVATTL |
| KPFLA.VAGTPERSGGFIE.PGSGST.GNPST..TTL.FRGG....V.........G..PVA... | |
| Retrocopy | KPFLAFVAGTPERSGGFIEIPGSGSTRGNPSTSVTTLGFRGGMAFNVVNVFLSGTSGQLPVANAM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP017611_brain | 0 .00 RPM | 0 .00 RPM |
| SRP017611_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000024961 | 1 retrocopy |
retro_cfam_1240 ,
|