RetrogeneDB ID: | retro_btau_505 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 13:5323264..5323437(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMEM14A | ||
| Ensembl ID: | ENSBTAG00000005206 | ||
| Aliases: | None | ||
| Description: | Transmembrane protein 14A [Source:UniProtKB/Swiss-Prot;Acc:P56982] |
| Percent Identity: | 70.49 % |
| Parental protein coverage: | 58.59 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | GAYRVSNDKRDVKLSL-FTAFFLATIMGVRFK-RSKKIMPAGLVAGLSLL-MILRLVLLLL |
| G.Y.VSN.K.D.KLSL..TA.FLAT.MGV.FK.RS.KI.PA.LVAG.SL..MILRLV.LLL | |
| Retrocopy | GSYCVSNEK*DGKLSL<LTALFLATVMGVTFK>RSEKITPAVLVAG*SLR<MILRLVSLLL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 25 .09 RPM |
| ERP005899_muscle | 0 .00 RPM | 10 .35 RPM |
| SRP017611_brain | 0 .05 RPM | 26 .13 RPM |
| SRP017611_kidney | 0 .00 RPM | 13 .10 RPM |
| SRP017611_liver | 0 .00 RPM | 10 .27 RPM |
| SRP030211_testis | 0 .01 RPM | 18 .40 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000005206 | 1 retrocopy |
retro_btau_505 ,
|
| Bos taurus | ENSBTAG00000005808 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000012581 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000016339 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000008935 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000005516 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000011162 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000004269 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000015237 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000004486 | 1 retrocopy |