RetrogeneDB ID: | retro_acar_117 | ||
Retrocopy location | Organism: | Anole lizard (Anolis carolinensis) | |
| Coordinates: | 4:22563599..22563926(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFB6 | ||
| Ensembl ID: | ENSACAG00000001263 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 76.58 % |
| Parental protein coverage: | 87.4 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | ELRRRWLKDQELSPREPVLPPEKPGLVEGFWQNFLKPGGLWRTQVYKTYKAGAFVFTGILVPFWLTHYYV |
| ..RRR....QEL.....V........V.G...NFLKPGGLWRTQVYKTYKAGAFVFTGILVPFWLTHYY. | |
| Retrocopy | DVRRRERYAQELRKGSTVTV*GESKEVKG--ENFLKPGGLWRTQVYKTYKAGAFVFTGILVPFWLTHYYI |
| Parental | KYHLLYQPYGAVVSKPKIFPGDTILETKEVVPPLEIPDSHH |
| KYHLLYQPYG.VVSKPKIFPGDTILET.EVVPPLEIPDSHH | |
| Retrocopy | KYHLLYQPYGVVVSKPKIFPGDTILETNEVVPPLEIPDSHH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP009831_adrenal | 0 .00 RPM | 108 .51 RPM |
| SRP009831_brain | 0 .05 RPM | 103 .67 RPM |
| SRP009831_dewlap | 0 .04 RPM | 80 .11 RPM |
| SRP009831_embryo | 0 .00 RPM | 79 .52 RPM |
| SRP009831_heart | 0 .00 RPM | 128 .72 RPM |
| SRP009831_liver | 0 .00 RPM | 141 .77 RPM |
| SRP009831_lung | 0 .00 RPM | 75 .11 RPM |
| SRP009831_ovary | 0 .00 RPM | 84 .75 RPM |
| SRP009831_skeletal_muscle | 0 .00 RPM | 127 .59 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000001263 | 3 retrocopies |
retro_acar_110, retro_acar_116, retro_acar_117 ,
|
| Callithrix jacchus | ENSCJAG00000007852 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000019864 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000007428 | 5 retrocopies | |
| Sus scrofa | ENSSSCG00000011003 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000013268 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000002785 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000012172 | 1 retrocopy |