RetrogeneDB ID: | retro_ptro_1256 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 18:19178549..19178747(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | HMGN1 | ||
| Ensembl ID: | ENSPTRG00000031426 | ||
| Aliases: | None | ||
| Description: | High mobility group nucleosome binding domain 1 [Source:UniProtKB/TrEMBL;Acc:K7DN21] |
| Percent Identity: | 72.73 % |
| Parental protein coverage: | 64. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MPKRKVSSAEGAAKEEPKRRSARLSAKP-PAKVEAKPK-KAAAKDKSSDKKVQTKGKRGAKGKQAE |
| MPKRKVSSA..A.KE.P.RR.A.LS..P.PAKVE.KPK.KAA.KDK.SD.KV.TKGK.GAKGK.AE | |
| Retrocopy | MPKRKVSSAKRAVKEKPRRRWAQLSPNPAPAKVETKPKTKAAGKDKPSDLKVHTKGKGGAKGKEAE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 24 .15 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 17 .57 RPM |
| SRP007412_heart | 0 .03 RPM | 17 .72 RPM |
| SRP007412_kidney | 0 .00 RPM | 44 .41 RPM |
| SRP007412_liver | 0 .00 RPM | 29 .20 RPM |
| SRP007412_testis | 0 .00 RPM | 38 .89 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1874 |