RetrogeneDB ID: | retro_ocun_844 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 15:81305582..81305823(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | VAMP4 | ||
| Ensembl ID: | ENSOCUG00000015967 | ||
| Aliases: | None | ||
| Description: | vesicle-associated membrane protein 4 [Source:HGNC Symbol;Acc:12645] |
| Percent Identity: | 82.72 % |
| Parental protein coverage: | 56.03 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | PPKFKRH-LNDDD-VTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQE |
| P.KFK.H.LNDDD..TGSVKSER.NLLE.DS.EEEDFFLRG.SGPR.GPRNDKIKHVQNQ.DEV.DVMQE | |
| Retrocopy | PSKFKGH>LNDDDDATGSVKSERKNLLEADSGEEEDFFLRGLSGPRLGPRNDKIKHVQNQMDEVTDVMQE |
| Parental | NITKVIERGER |
| NIT.VIERG.R | |
| Retrocopy | NITQVIERGDR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 25 .61 RPM |
| SRP017611_kidney | 0 .00 RPM | 10 .54 RPM |
| SRP017611_liver | 0 .00 RPM | 4 .39 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000016956 | 1 retrocopy | |
| Felis catus | ENSFCAG00000013371 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000011226 | 13 retrocopies | |
| Monodelphis domestica | ENSMODG00000003811 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015609 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000015967 | 1 retrocopy |
retro_ocun_844 ,
|
| Otolemur garnettii | ENSOGAG00000026745 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000014342 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000017179 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000007424 | 1 retrocopy |