RetrogeneDB ID: | retro_fcat_1570 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
| Coordinates: | D4:896185..896600(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSFCAG00000027526 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS15 | ||
| Ensembl ID: | ENSFCAG00000010769 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S15 [Source:HGNC Symbol;Acc:10388] |
| Percent Identity: | 66.67 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | MAEVEQKKKRTFRKFTYRGV-DLDQLLDMSY-EQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKAKKEAP |
| .AEVEQK..R..RKFTY....DL.QLL..S..E.LMQLYS..Q..RLN..L..K.HSL...L.KAKKEAP | |
| Retrocopy | VAEVEQKEQRALRKFTYHDM<DLGQLLGVSL<EPLMQLYSTLQWQRLNWSLWGKHHSLM--LSKAKKEAP |
| Parental | PMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHS |
| .M..P....THLRD..ILPE....M.GVYNGK.FNQVEIKPEMIGHYLGEFSITYKP.KHGRPG..ATHS | |
| Retrocopy | FMRSPRWLRTHLRDVVILPE----MGGVYNGKIFNQVEIKPEMIGHYLGEFSITYKPMKHGRPGMEATHS |
| Parental | SRFIPLK |
| S..I.LK | |
| Retrocopy | SSYILLK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 27 .66 RPM |
| SRP017611_kidney | 0 .00 RPM | 85 .13 RPM |
| SRP017611_liver | 0 .00 RPM | 40 .13 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000019718 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000005632 | 13 retrocopies | |
| Cavia porcellus | ENSCPOG00000003968 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000008645 | 1 retrocopy | |
| Felis catus | ENSFCAG00000010769 | 1 retrocopy |
retro_fcat_1570 ,
|
| Homo sapiens | ENSG00000115268 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000002818 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000005119 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000063457 | 8 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000001651 | 8 retrocopies | |
| Otolemur garnettii | ENSOGAG00000015776 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000009317 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000010200 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000003168 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000024603 | 8 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000006423 | 2 retrocopies |