RetrogeneDB ID: | retro_cfam_545 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 13:26733491..26733929(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | HSD17B10 | ||
| Ensembl ID: | ENSCAFG00000016277 | ||
| Aliases: | None | ||
| Description: | hydroxysteroid (17-beta) dehydrogenase 10 [Source:HGNC Symbol;Acc:4800] |
| Percent Identity: | 70.95 % |
| Parental protein coverage: | 55.94 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 2 |
| Parental | MAAAC-RGVKGLVALVTGGASGLGLATAERLVGQGATAVLLDLPNSDGEVQAKKLGKNCTFAAADVTSEK |
| MA.AC.R..KGLV.L.T.G.S.LGL..AERLVG.GA.AVLLDL.NSDGE.QAKKLGK.C.FA..D.TSEK | |
| Retrocopy | MAVAC>RDMKGLVTLITRGVSSLGLVMAERLVG*GAIAVLLDLRNSDGEAQAKKLGKSCPFAPGDMTSEK |
| Parental | DVQAALTLAKEKFGRVDVAVNCAGIAVAIKTYNLKKNQAHTLEDFQRVLNV-NLLGTFNVIRLVAGEMGQ |
| .VQAALTL.KEKFG.VD.AVN.....VAI.TYN.KKNQA.TL.DFQ.VLNV.NL..TFN...LV.GEM.Q | |
| Retrocopy | NVQAALTLIKEKFGQVDLAVNWTDSVVAI*TYNFKKNQAPTLSDFQQVLNV<NLIDTFNMFHLVVGEMRQ |
| Parental | NEPDQGGQ |
| N.PDQGGQ | |
| Retrocopy | NQPDQGGQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 41 .07 RPM |
| SRP017611_brain | 0 .00 RPM | 23 .90 RPM |
| SRP017611_kidney | 0 .00 RPM | 159 .28 RPM |
| SRP017611_liver | 0 .00 RPM | 39 .52 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000005036 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000005927 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000007520 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000014368 | 4 retrocopies | |
| Canis familiaris | ENSCAFG00000016277 | 1 retrocopy |
retro_cfam_545 ,
|
| Choloepus hoffmanni | ENSCHOG00000000939 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000009594 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000004051 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000005080 | 1 retrocopy | |
| Felis catus | ENSFCAG00000013899 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000008565 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000000175 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000002951 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000005340 | 3 retrocopies | |
| Xenopus tropicalis | ENSXETG00000007721 | 1 retrocopy |