RetrogeneDB ID: | retro_ttru_530 | ||
Retrocopy location | Organism: | Dolphin (Tursiops truncatus) | |
| Coordinates: | GeneScaffold_2604:42119..42307(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NPM2 | ||
| Ensembl ID: | ENSTTRG00000008050 | ||
| Aliases: | None | ||
| Description: | nucleophosmin/nucleoplasmin 2 [Source:HGNC Symbol;Acc:7930] |
| Percent Identity: | 61.76 % |
| Parental protein coverage: | 51.94 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | DEDTDVSLEKETPVKQVKRLAPQKHTSIAKKKKVEKEE-VAVRYHPKDRSPVGKAKTTPRPKKPGFKK |
| ..D.DVSLE.ETPVKQVKRL.PQK.T.I....KVEKEE..AVR...KD.SPV..AK....P.K.G.KK | |
| Retrocopy | NDDVDVSLEEETPVKQVKRLVPQKQTNITEEEKVEKEE<EAVRTSLKDKSPVRRAK----PEKLGSKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Monodelphis domestica | ENSMODG00000009677 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000008050 | 1 retrocopy |
retro_ttru_530 ,
|