RetrogeneDB ID: | retro_ttru_287 | ||
Retrocopy location | Organism: | Dolphin (Tursiops truncatus) | |
| Coordinates: | GeneScaffold_1773:427333..427517(-) | ||
| Located in intron of: | ENSTTRG00000003071 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSTTRG00000002964 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 62.5 % |
| Parental protein coverage: | 51.67 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE-KGFGY-KGSCFHRIIPGFMCQGG |
| PT.FFDI.V.GE.L..VSF.LFADKVPKTAE.......GE.KGF...KG.CFHRI..GF.C..G | |
| Retrocopy | PTLFFDITVKGETLRHVSFNLFADKVPKTAEYLHSELWGE<KGFVV<KGWCFHRILLGFVCDNG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000011597 | 12 retrocopies | |
| Monodelphis domestica | ENSMODG00000016089 | 9 retrocopies | |
| Tursiops truncatus | ENSTTRG00000002964 | 16 retrocopies | |
| Tursiops truncatus | ENSTTRG00000014385 | 1 retrocopy |