RetrogeneDB ID: | retro_ttru_1596 | ||
Retrocopy location | Organism: | Dolphin (Tursiops truncatus) | |
| Coordinates: | scaffold_48546:399..611(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSTTRG00000021375 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSTTRG00000009156 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 53.33 % |
| Parental protein coverage: | 79.57 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | EEGVEEAENGREAPANGNANEENGEQEADNEVDEEEEEGGEEEEEEEEGDGE-EEDGDEDEEAEAATGKR |
| EE.VEEAENGR.APA.GNA.EENGEQEAD..VDEE.E............DG...ED.D.D......T.KR | |
| Retrocopy | EEVVEEAENGRGAPARGNASEENGEQEADSKVDEEAEDMKVRRPTQLRADGQ<AEDEDDD---DVDTKKR |
| Parental | AAEDD |
| ....D | |
| Retrocopy | KTDED |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000006234 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000000300 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000009156 | 2 retrocopies |
retro_ttru_1596 , retro_ttru_1609,
|