RetrogeneDB ID: | retro_ttru_1200 | ||
Retrocopy location | Organism: | Dolphin (Tursiops truncatus) | |
| Coordinates: | scaffold_106996:5282..5525(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ZBTB8OS | ||
| Ensembl ID: | ENSTTRG00000014968 | ||
| Aliases: | None | ||
| Description: | zinc finger and BTB domain containing 8 opposite strand [Source:HGNC Symbol;Acc:24094] |
| Percent Identity: | 51.81 % |
| Parental protein coverage: | 55.7 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | AMAMFGYMTDTGTVEPLQATEVETQGDDLQSLLFHFLNEWLYKFSADEFFIAREVKVLNIDQRNFKLRSI |
| A.A.FG.M..TGT...LQ..E.ET.GDDL.S..FHFL...LYKFS.D..FI...VKVLN........... | |
| Retrocopy | AIALFGFMIHTGTLNLLQMVEIETPGDDL*SPVFHFLDKGLYKFSTDLSFIPWDVKVLNTGXXXXNFLGW |
| Parental | GWGEEFSLSKHPQ |
| G..EE.SL.KH.Q | |
| Retrocopy | G--EEYSLFKHLQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000010550 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000004061 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000015349 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000001861 | 2 retrocopies | |
| Equus caballus | ENSECAG00000020982 | 1 retrocopy | |
| Felis catus | ENSFCAG00000000700 | 1 retrocopy | |
| Homo sapiens | ENSG00000176261 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000007519 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000000745 | 5 retrocopies | |
| Macaca mulatta | ENSMMUG00000009939 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017419 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000057572 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000000940 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000011630 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000001589 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000014968 | 1 retrocopy |
retro_ttru_1200 ,
|