RetrogeneDB ID: | retro_tsyr_1697 | ||
Retrocopy location | Organism: | Tarsier (Tarsius syrichta) | |
| Coordinates: | scaffold_54784:3126..3330(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMEM65 | ||
| Ensembl ID: | ENSTSYG00000002828 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 65 [Source:HGNC Symbol;Acc:25203] |
| Percent Identity: | 80.0 % |
| Parental protein coverage: | 50.72 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | KLEAPPPTPGQLRYVFIHNAIPFVGFGFLDNAIMIVAGTHIEMSIGIILGISTMAAAALGNLVSDLAGLG |
| KLEAPPPTP.Q.R.VFI.NAIPF.G.GFLDNAIMIVA...IE.SIGII.GISTMAAAALGNL.S.L.GLG | |
| Retrocopy | KLEAPPPTPEQVRGVFILNAIPFRGLGFLDNAIMIVA--*IELSIGIIWGISTMAAAALGNLMSHLNGLG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Felis catus | ENSFCAG00000026901 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000000828 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000002828 | 1 retrocopy |
retro_tsyr_1697 ,
|