RetrogeneDB ID: | retro_tsyr_1105 | ||
Retrocopy location | Organism: | Tarsier (Tarsius syrichta) | |
| Coordinates: | scaffold_306725:1488..1739(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSTSYG00000006901 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 68.24 % |
| Parental protein coverage: | 51.57 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | SEEEVKAGGDETVVADLLVNAVYVLGAILKIFLR-GNVLN-HSGMDIEKYSKHYQHDHSPGAEDDAAGGQ |
| S.EEVKAGGDE.VVA..LVN.V.VLG.ILKIFLR..NVLN.HSGMDIEKYS.H.Q...SPG.ED...G.Q | |
| Retrocopy | SQEEVKAGGDEAVVAGMLVNVVCVLGPILKIFLR*VNVLN*HSGMDIEKYSEHCQPNRSPGTED*DTGSQ |
| Parental | LRPT-AQERRHKERG |
| LRPT.....RH.E.G | |
| Retrocopy | LRPT<TAQERHHEQG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000015517 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000014057 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000006901 | 2 retrocopies |
retro_tsyr_1105 , retro_tsyr_1738,
|