RetrogeneDB ID: | retro_tbel_4134 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | scaffold_68358:1908..2110(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFA4L2 | ||
| Ensembl ID: | ENSTBEG00000015731 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2 [Source:HGNC Symbol;Acc:29836] |
| Percent Identity: | 59.42 % |
| Parental protein coverage: | 78.16 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | LIPMIGFIGLGMGSAALY-LLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF |
| LIP...F.G.G.GS.A...L..LA...PDV.WDRKNNPEPWN.L.PNDQ.....V..DY.KLKK..PDF | |
| Retrocopy | LIPLFLFTGAG-GSGAAL>LMCLAVFNPDVSWDRKNNPEPWNKLGPNDQCRLYSVNEDYSKLKKEGPDF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000004466 | 1 retrocopy | |
| Homo sapiens | ENSG00000185633 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000021950 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000014358 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000017371 | 10 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000020476 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000015731 | 5 retrocopies | |
| Tupaia belangeri | ENSTBEG00000016629 | 16 retrocopies |