RetrogeneDB ID: | retro_tbel_2828 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | scaffold_120389:28012..28217(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMEM243 | ||
| Ensembl ID: | ENSTBEG00000007846 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 243, mitochondrial [Source:HGNC Symbol;Acc:21707] |
| Percent Identity: | 60.56 % |
| Parental protein coverage: | 64.49 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | IINLVVGILTSLLILVTLISAFV-FPQLPPKPLN-IFFAVCISLSSITACILIYWYRQGDLEPKFRKLIY |
| II...VG.LTSL.....LISAFV..P....K....I.F....SLSSITACI.IYWY.Q.DLE.KFRKLIY | |
| Retrocopy | IIYIFVGSLTSLMVPGILISAFV<LPSTASKDIE<IYFLLSTSLSSITACIRIYWYQQRDLELKFRKLIY |
| Parental | Y |
| Y | |
| Retrocopy | Y |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000004888 | 4 retrocopies | |
| Microcebus murinus | ENSMICG00000014707 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000000023 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042758 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000002439 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000007846 | 3 retrocopies |
retro_tbel_2016, retro_tbel_2828 , retro_tbel_4176,
|