RetrogeneDB ID: | retro_sscr_140 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 1:264465940..264466168(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TRIAP1 | ||
| Ensembl ID: | ENSSSCG00000009908 | ||
| Aliases: | None | ||
| Description: | TP53 regulated inhibitor of apoptosis 1 [Source:HGNC Symbol;Acc:26937] |
| Percent Identity: | 65.38 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | MNSVGEGCTDMKREYDQCFNRWFAEKFLKGEGSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLDCWWAGLS |
| MNSVGE.CTDMK.E.DQCF..W.A.KFL.GEGS.DPC.DLF..Y.QCVQKAIK.KE.P.EGL.....G.. | |
| Retrocopy | MNSVGEACTDMKHE*DQCFKSWLAKKFLQGEGSRDPCADLF*HYKQCVQKAIKDKEMPLEGLE--FMGRG |
| Parental | KKKPAFNS |
| K.KP...S | |
| Retrocopy | KEKPDSSS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 5 .04 RPM |
| SRP014902_testis | 0 .00 RPM | 4 .38 RPM |
| SRP018288_heart | 0 .00 RPM | 15 .22 RPM |
| SRP018288_kidney | 0 .00 RPM | 31 .32 RPM |
| SRP018288_liver | 0 .16 RPM | 16 .95 RPM |
| SRP018288_lung | 0 .00 RPM | 5 .50 RPM |
| SRP018856_adipose | 0 .00 RPM | 11 .27 RPM |
| SRP035408_brain | 0 .00 RPM | 1 .81 RPM |
| SRP035408_liver | 0 .00 RPM | 5 .37 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Sus scrofa | ENSSSCG00000009908 | 2 retrocopies |
retro_sscr_140 , retro_sscr_227,
|