RetrogeneDB ID: | retro_sscr_1096 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | GL893950.2:4593..4797(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSSCG00000024597 | ||
| Aliases: | None | ||
| Description: | None |
Retrocopy-Parental alignment summary:
>retro_sscr_1096
CCCAAGTCAAGGCCAGCCCCTGCGCCTATGCCCCTACCCCGCAGCTACCAACAAGGCCATCGGTGCTTGGAGCAAGAAGA
CTGGGAGGTGGCCGTGCTGTTCTTCTCCCGAGCCCTCCACCTGGACTCCCAGATGGTGAGGGGAAGGGCCTGGGAGGGGG
ACGGCCCCCTCCCTGTGGCACCTGCAGGCCTCTCCTCTCAGAGC
ORF - retro_sscr_1096 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 52.94 % |
| Parental protein coverage: | 51.91 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | PKSTGLPVLLKIKEYYQQGHRCLEQEDWEVAVLFFSRALHLDSQMIEFYALRAEAYIQLCDFSSAAQN |
| PKS...P........YQQGHRCLEQEDWEVAVLFFSRALHLDSQM....A................Q. | |
| Retrocopy | PKSRPAPAPMPLPRSYQQGHRCLEQEDWEVAVLFFSRALHLDSQMVRGRAWEGDGPLPVAPAGLSSQS |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 0 .00 RPM |
| SRP014902_testis | 0 .00 RPM | 0 .57 RPM |
| SRP018288_heart | 0 .05 RPM | 0 .08 RPM |
| SRP018288_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP018288_liver | 0 .16 RPM | 0 .00 RPM |
| SRP018288_lung | 0 .00 RPM | 0 .61 RPM |
| SRP018856_adipose | 0 .00 RPM | 0 .00 RPM |
| SRP035408_brain | 0 .00 RPM | 0 .00 RPM |
| SRP035408_liver | 0 .00 RPM | 0 .00 RPM |
Sus scrofa was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_sscr_1096 retrocopy.
Sus scrofa was not studied using FANTOM5 data.
retro_sscr_1096 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_sscr_1096 has 0 orthologous retrocopies within eutheria group .Parental genes homology:
Parental genes homology involve 1 parental gene, and 1 retrocopy.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Sus scrofa | ENSSSCG00000024597 | 1 retrocopy |
retro_sscr_1096 ,
|