RetrogeneDB ID: | retro_pabe_3236 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 7_random:12765739..12765981(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPPYG00000018258 | ||
| Aliases: | None | ||
| Description: | None |
Retrocopy-Parental alignment summary:
>retro_pabe_3236
TGTCCACAAGTCGGCCTCTCAAGGCCCAGCTCCTGGCTTTTGTTGGCGTCTCCAGGCCCAGCTTCTGCCCCCACGTGGCC
TCTACAGGCCGTGCTCTTTCTTCTGACTGTGTGTGGAGGTCCAACTCCTGCCTCAGAACAACCTCTTCTGGCTCAGCTCC
CGCCCAGCTCCTAGTGGCCTTTGTAGGCCCCAAACTGCCTCAAGTCAAGCTTTCCAGGCCCACCTTCTGCCTCCCAATGG
CC
ORF - retro_pabe_3236 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 56.1 % |
| Parental protein coverage: | 61.42 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
Retrocopy - Parental Gene Alignment:
| Parental | CP--GMSSPGLKLPFS-LSSPSYCL-LASPGPALPPGCVYRPGSCVTATALDSAPAQLLVAFGGPKLPQA |
| CP..G.S.P...L.....S.PS.C...AS.G.AL...CV.R..SC...T...SAPAQLLVAF.GPKLPQ. | |
| Retrocopy | CPQVGLSRPSSWLLLA<VSRPSFCPHVASTGRALSSDCVWRSNSCLRTTSSGSAPAQLLVAFVGPKLPQV |
| Parental | KLCRPAFCLPVA |
| KL.RP.FCLP.A | |
| Retrocopy | KLSRPTFCLPMA |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 0 .11 RPM |
| SRP007412_cerebellum | 0 .12 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .03 RPM |
| SRP007412_kidney | 0 .23 RPM | 0 .23 RPM |
| SRP007412_liver | 0 .12 RPM | 0 .06 RPM |
Pongo abelii was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_pabe_3236 retrocopy.
Pongo abelii was not studied using FANTOM5 data.
retro_pabe_3236 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_pabe_3236 has 0 orthologous retrocopies within eutheria group .Parental genes homology:
Parental genes homology involve 2 parental genes, and 5 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Macaca mulatta | ENSMMUG00000000034 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000018258 | 4 retrocopies |