RetrogeneDB ID: | retro_pabe_2764 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 5:100524699..100525119(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CENPO | ||
| Ensembl ID: | ENSPPYG00000012596 | ||
| Aliases: | None | ||
| Description: | centromere protein O [Source:HGNC Symbol;Acc:28152] |
| Percent Identity: | 65.49 % |
| Parental protein coverage: | 57.38 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | LEEIAAKYLQTNIQHFLFSLCEYLNAYSGRKYQADRLQSDFAA-LLTGPLQRNPLCNLLSFTYKLDPGGQ |
| LEE.AA..LQT.IQHFL.S.C.YL.A.SGRK.QA..LQSD....L..GPLQRN.L.N..SFTYKLDP.G. | |
| Retrocopy | LEETAAEHLQTDIQHFLLSFCKYLTAHSGRKWQAH*LQSDCRL>LSDGPLQRNSL*NFSSFTYKLDPMGN |
| Parental | -SFPFCARLLYKDLTATLPTDVTVTCQGVEALSTSWEEQRASHETLFCTKPLHQVFASFARKGEKLDMSL |
| ..F.F.ARL..K..T.TLPTD.TVT.QG.E...TSWE.Q.ASHETLFC.K.LHQ.F.SFARKG...DM.L | |
| Retrocopy | <PFSFGARLMEKNFTITLPTDLTVTYQGIEVSFTSWEAQEASHETLFCMKCLHQDFPSFARKGKMFDMNL |
| Parental | VS |
| VS | |
| Retrocopy | VS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 4 .92 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 4 .50 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .75 RPM |
| SRP007412_kidney | 0 .00 RPM | 2 .32 RPM |
| SRP007412_liver | 0 .00 RPM | 1 .10 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Macropus eugenii | ENSMEUG00000010491 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012596 | 1 retrocopy |
retro_pabe_2764 ,
|
| Rattus norvegicus | ENSRNOG00000050111 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000005861 | 1 retrocopy |