RetrogeneDB ID: | retro_pabe_2380 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 3:171207898..171208109(-) | ||
| Located in intron of: | ENSPPYG00000029750 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HMGN1 | ||
| Ensembl ID: | ENSPPYG00000011426 | ||
| Aliases: | None | ||
| Description: | high mobility group nucleosome binding domain 1 [Source:HGNC Symbol;Acc:4984] |
| Percent Identity: | 59.15 % |
| Parental protein coverage: | 69.0 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | MPKRKVSSAEGAAKEEPKRRSARLSAKPP-AKVEAKPKKAAAK-DKSSDKKVQTKGKRGAKGKQAEVANQ |
| MPKR.VSSA.G..KEEPKRR...LS.KP....VE........K..KSS.KKVQTK.KR.AK.K.A.VAN. | |
| Retrocopy | MPKRMVSSADGTVKEEPKRRLMWLSDKPALSVVEIEAPEGSRK>HKSSGKKVQTKEKRVAK*K*AKVAN* |
| Parental | E |
| E | |
| Retrocopy | E |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 21 .67 RPM |
| SRP007412_cerebellum | 0 .12 RPM | 44 .75 RPM |
| SRP007412_heart | 0 .03 RPM | 14 .33 RPM |
| SRP007412_kidney | 0 .07 RPM | 76 .60 RPM |
| SRP007412_liver | 0 .06 RPM | 35 .83 RPM |