RetrogeneDB ID: | retro_pabe_1934 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 2a:21467421..21467632(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPPYG00000018998 | ||
| Aliases: | None | ||
| Description: | None |
Retrocopy-Parental alignment summary:
>retro_pabe_1934
GAGGCGGGCGGATCACGAGGTCAGGAGATCGAGACCATCTTGGCTAACACCGTGAAACCCCGTCTTTACTAAAAATACAA
AAAATTAGCCGGGCGAGGCAGCGGGCGCCTGTAGTCCCAGCTAATCAGGAGGCTGAGGCAGAATGATGGCGTGAACCCCG
GGGGGCGGAGCCTGCAGTGAGCTGAGATCGCGCTACTGCACTCCAGCCTGG
ORF - retro_pabe_1934 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 56.34 % |
| Parental protein coverage: | 83.13 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
Retrocopy - Parental Gene Alignment:
| Parental | EAGRSQGQEIETILANMVKPLLW-EAEVMAGRGGSRLPKWLLGRLRQENCSN-SGGGGCSKSRLCHCSPA |
| EAG.S.GQEIETILAN.VKP.L.......AGRG..RL...L..RLRQ....N..GGG.CS..R...C.PA | |
| Retrocopy | EAGGSRGQEIETILANTVKPRLY*KYKKLAGRGSGRL*SQLIRRLRQNDGVN>PGGGACSELRSRYCTPA |
| Parental | W |
| W | |
| Retrocopy | W |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
Pongo abelii was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_pabe_1934 retrocopy.
Pongo abelii was not studied using FANTOM5 data.
retro_pabe_1934 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_pabe_1934 has 0 orthologous retrocopies within eutheria group .Parental genes homology:
Parental genes homology involve 1 parental gene, and 1 retrocopy.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Pongo abelii | ENSPPYG00000018998 | 1 retrocopy |
retro_pabe_1934 ,
|