RetrogeneDB ID: | retro_pabe_1369 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 16:77103540..77103899(+) | ||
| Located in intron of: | ENSPPYG00000007663 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CMPK1 | ||
| Ensembl ID: | ENSPPYG00000001380 | ||
| Aliases: | None | ||
| Description: | cytidine monophosphate (UMP-CMP) kinase 1, cytosolic [Source:HGNC Symbol;Acc:18170] |
| Percent Identity: | 70.4 % |
| Parental protein coverage: | 53.07 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 4 |
| Parental | EMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMD-GKADVSFVLFFDCNNEICIERCLER-GKSSGRSD |
| EMDQTMAANA.KNKFLID.F.RNQDNLQ.W.K.MD.GKADV..VLF.D.NNEICI..CLER.G.S.G.S. | |
| Retrocopy | EMDQTMAANA-KNKFLIDKFLRNQDNLQDWAKSMD>GKADVHLVLFSDHNNEICIKGCLER>GNS-GNSE |
| Parental | DNRESLEKRIQTYLQ-STKPIIDLYEEMGKVKKIDASKSVDEV-FDEVVQIFDKE |
| ..RESL.KRIQT.LQ..TK.I.D.YEE.GKV.K.DASK.VDEV.F.EVV.I..K. | |
| Retrocopy | ASRESLGKRIQTHLQ>LTKTITDSYEEIGKVNKADASKPVDEV<FSEVVKISNKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 17 .36 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 20 .19 RPM |
| SRP007412_heart | 0 .00 RPM | 12 .64 RPM |
| SRP007412_kidney | 0 .00 RPM | 23 .77 RPM |
| SRP007412_liver | 0 .03 RPM | 32 .16 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000012 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000004014 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000021250 | 2 retrocopies | |
| Felis catus | ENSFCAG00000025426 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000017375 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026904 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001380 | 1 retrocopy |
retro_pabe_1369 ,
|
| Sorex araneus | ENSSARG00000009745 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000003885 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000017494 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000007511 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000004127 | 2 retrocopies |