RetrogeneDB ID: | retro_oind_68 | ||
Retrocopy location | Organism: | Rice subsp. indica (Oryza sativa indica) | |
| Coordinates: | 1:9631228..9631447(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | BGIOSGA003192 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 56.16 % |
| Parental protein coverage: | 77.66 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | VKRSSFLLVVVVFALLLLTSMAAGGRKMLINKHQVQSMETSDDESMHQGQEDDEMLAMVHERILRQVKTN |
| ..R.......V...L..L.S..........N.......ETSDDESMHQGQEDDEMLAMVHERILRQVKTN | |
| Retrocopy | IERRISIYI*VIRKLIKLLSC*CLNLYLIANSMCACMQETSDDESMHQGQEDDEMLAMVHERILRQVKTN |
| Parental | DYG |
| DYG | |
| Retrocopy | DYG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Oryza sativa indica | BGIOSGA003192 | 1 retrocopy |
retro_oind_68 ,
|