RetrogeneDB ID: | retro_ocun_967 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 18:13547071..13547290(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HYPK | ||
| Ensembl ID: | ENSOCUG00000001161 | ||
| Aliases: | None | ||
| Description: | huntingtin interacting protein K (HYPK), mRNA [Source:RefSeq mRNA;Acc:NM_001171256] |
| Percent Identity: | 58.11 % |
| Parental protein coverage: | 56.06 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | QSSNLETAMSVIGDRRSREQKAKQEREKELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNVVEALI |
| ..SNLE...S..GDR.S.........EKELA.VTIKKEDLELI.TE.E.S.AAA..SL..H.GN..EA.I | |
| Retrocopy | EGSNLEMTRSITGDRLSGSRNLNRQ-EKELAEVTIKKEDLELILTEKETSQAAAKASLQKHTGNMLEAFI |
| Parental | ALTN |
| A.TN | |
| Retrocopy | AQTN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 34 .44 RPM |
| SRP017611_kidney | 0 .00 RPM | 21 .49 RPM |
| SRP017611_liver | 0 .00 RPM | 8 .17 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000002541 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000007464 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000014809 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000013059 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017744 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005454 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000001161 | 2 retrocopies |
retro_ocun_1395, retro_ocun_967 ,
|
| Otolemur garnettii | ENSOGAG00000010201 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006424 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000038721 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000015703 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000006916 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000003726 | 1 retrocopy |